Recombinant Mouse Z-DNA-binding protein 1 (Zbp1)

Catalog Number: CSB-EP865587MOA6
Article Name: Recombinant Mouse Z-DNA-binding protein 1 (Zbp1)
Biozol Catalog Number: CSB-EP865587MOA6
Supplier Catalog Number: CSB-EP865587MOa6
Alternative Catalog Number: CSB-EP865587MOA6-1, CSB-EP865587MOA6-100, CSB-EP865587MOA6-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: DNA-dependent activator of IFN-regulatory factors,DAI,Tumor stroma and activated macrophage protein DLM-1
Molecular Weight: 58.9 kDa
Tag: N-terminal 6xHis-B2M-tagged
UniProt: Q9QY24
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-411aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEAPVDLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGGAASGDGAPAIPENSSAQPSLDERILRFLEANGPHRALHIAKALGMTTAKEVNPLLYSMRNKHLLSYDGQTWKIYHSRQEGQDIAHSGVTQESPAIICQHNPVNMICQQGANSHISIANSNAIQIGHGNVIVREKACGEPGPRTSHPLPLAWDASAQDMPPVAHGAQYIYMDKSLLQQVQLGHHNE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.