Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)

Artikelnummer: CSB-EP873379DOA
Artikelname: Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)
Artikelnummer: CSB-EP873379DOA
Hersteller Artikelnummer: CSB-EP873379DOA
Alternativnummer: CSB-EP873379DOA-1, CSB-EP873379DOA-100, CSB-EP873379DOA-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Hydroxycinnamate 4-beta-glucosyltransferase UGT72E2
Molekulargewicht: 60.4 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9LVR1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-481aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MHITKPHAAMFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGVDIVKLPSPDIYGLVDPDDHVVTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLFGTDALCLAKEFNMLSYVFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAYLVPDEPVYRDFVRHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPLCRPIQSSETDHPVLD
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.