Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)

Catalog Number: CSB-EP873379DOA
Article Name: Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2)
Biozol Catalog Number: CSB-EP873379DOA
Supplier Catalog Number: CSB-EP873379DOA
Alternative Catalog Number: CSB-EP873379DOA-1, CSB-EP873379DOA-100, CSB-EP873379DOA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Hydroxycinnamate 4-beta-glucosyltransferase UGT72E2
Molecular Weight: 60.4 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9LVR1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-481aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MHITKPHAAMFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGVDIVKLPSPDIYGLVDPDDHVVTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLFGTDALCLAKEFNMLSYVFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAYLVPDEPVYRDFVRHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPLCRPIQSSETDHPVLD