Recombinant Human GMP reductase 2 (GMPR2)
Artikelnummer:
CSB-EP873740HU
- Bilder (0)
| Artikelname: | Recombinant Human GMP reductase 2 (GMPR2) |
| Artikelnummer: | CSB-EP873740HU |
| Hersteller Artikelnummer: | CSB-EP873740HU |
| Alternativnummer: | CSB-EP873740HU-1, CSB-EP873740HU-100, CSB-EP873740HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Guanosine 5-monophosphate oxidoreductase 2 ,Guanosine monophosphate reductase 2 |
| Molekulargewicht: | 55.8 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | Q9P2T1 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1-366aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGAD |
Produktgarantie und fachkundiger Support
