Recombinant Human GMP reductase 2 (GMPR2)

Catalog Number: CSB-EP873740HU
Article Name: Recombinant Human GMP reductase 2 (GMPR2)
Biozol Catalog Number: CSB-EP873740HU
Supplier Catalog Number: CSB-EP873740HU
Alternative Catalog Number: CSB-EP873740HU-1, CSB-EP873740HU-100, CSB-EP873740HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Guanosine 5-monophosphate oxidoreductase 2 ,Guanosine monophosphate reductase 2
Molecular Weight: 55.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q9P2T1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-366aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGAD