Recombinant Dog Prorelaxin (RLN)

Artikelnummer: CSB-EP874666DO
Artikelname: Recombinant Dog Prorelaxin (RLN)
Artikelnummer: CSB-EP874666DO
Hersteller Artikelnummer: CSB-EP874666DO
Alternativnummer: CSB-EP874666DO-1, CSB-EP874666DO-100, CSB-EP874666DO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 23.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9TRM8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 26-177aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.