Recombinant Dog Prorelaxin (RLN)

Catalog Number: CSB-EP874666DO
Article Name: Recombinant Dog Prorelaxin (RLN)
Biozol Catalog Number: CSB-EP874666DO
Supplier Catalog Number: CSB-EP874666DO
Alternative Catalog Number: CSB-EP874666DO-1, CSB-EP874666DO-100, CSB-EP874666DO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 23.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9TRM8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 26-177aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.