Recombinant Human Tight junction protein 2 (TJP2), partial

Artikelnummer: CSB-EP880071HU
Artikelname: Recombinant Human Tight junction protein 2 (TJP2), partial
Artikelnummer: CSB-EP880071HU
Hersteller Artikelnummer: CSB-EP880071HU
Alternativnummer: CSB-EP880071HU-1, CSB-EP880071HU-100, CSB-EP880071HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Tight junction protein ZO-2,Zona occludens protein 2,Zonula occludens protein 2
Molekulargewicht: 16.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9UDY2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 33-120aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPR
Anwendungsbeschreibung: Research Areas: Cell Biology