Recombinant Human Tight junction protein 2 (TJP2), partial

Catalog Number: CSB-EP880071HU
Article Name: Recombinant Human Tight junction protein 2 (TJP2), partial
Biozol Catalog Number: CSB-EP880071HU
Supplier Catalog Number: CSB-EP880071HU
Alternative Catalog Number: CSB-EP880071HU-1, CSB-EP880071HU-100, CSB-EP880071HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Tight junction protein ZO-2,Zona occludens protein 2,Zonula occludens protein 2
Molecular Weight: 16.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9UDY2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 33-120aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPR
Application Notes: Research Areas: Cell Biology