Recombinant Human Glutaminase liver isoform, mitochondrial (GLS2)

Artikelnummer: CSB-EP887058HU
Artikelname: Recombinant Human Glutaminase liver isoform, mitochondrial (GLS2)
Artikelnummer: CSB-EP887058HU
Hersteller Artikelnummer: CSB-EP887058HU
Alternativnummer: CSB-EP887058HU-1, CSB-EP887058HU-100, CSB-EP887058HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: L-glutaminase L-glutamine amidohydrolase
Molekulargewicht: 80.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q9UI32
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 15-602aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNA