Recombinant Human Glutaminase liver isoform, mitochondrial (GLS2)
Catalog Number:
CSB-EP887058HU
- Images (0)
| Article Name: | Recombinant Human Glutaminase liver isoform, mitochondrial (GLS2) |
| Biozol Catalog Number: | CSB-EP887058HU |
| Supplier Catalog Number: | CSB-EP887058HU |
| Alternative Catalog Number: | CSB-EP887058HU-1, CSB-EP887058HU-100, CSB-EP887058HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | L-glutaminase L-glutamine amidohydrolase |
| Molecular Weight: | 80.7 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | Q9UI32 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 15-602aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNA |
Product Guarantee and Expert Support
