Recombinant Drosophila melanogaster Cilia- and flagella-associated protein 20 (Bug22)

Artikelnummer: CSB-EP892862DLU
Artikelname: Recombinant Drosophila melanogaster Cilia- and flagella-associated protein 20 (Bug22)
Artikelnummer: CSB-EP892862DLU
Hersteller Artikelnummer: CSB-EP892862DLU
Alternativnummer: CSB-EP892862DLU-1, CSB-EP892862DLU-100, CSB-EP892862DLU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Basal body up-regulated protein 22
Molekulargewicht: 30.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9VKV8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-199aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADPKKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQKPVQKSNAICS
Anwendungsbeschreibung: Research Areas: Others. Endotoxin: Not test