Recombinant Drosophila melanogaster Cilia- and flagella-associated protein 20 (Bug22)

Catalog Number: CSB-EP892862DLU
Article Name: Recombinant Drosophila melanogaster Cilia- and flagella-associated protein 20 (Bug22)
Biozol Catalog Number: CSB-EP892862DLU
Supplier Catalog Number: CSB-EP892862DLU
Alternative Catalog Number: CSB-EP892862DLU-1, CSB-EP892862DLU-100, CSB-EP892862DLU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Basal body up-regulated protein 22
Molecular Weight: 30.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9VKV8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-199aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MFKNTFQSGFLSILYSIGSKPLQLWDKKVRNGHIKRITDNDIQSLVLEIVGTNVSTTFITCPADPKKTLGIKLPFLVMIIKNMKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDEGWNQIQFNLSDFTRRAYGTNYVETLRVQIHANCRIRRVYFSDRLYSEDELPPEFKLFLPIQKPVQKSNAICS
Application Notes: Research Areas: Others. Endotoxin: Not test