Recombinant Human E3 SUMO-protein ligase PIAS3 (PIAS3), partial

Artikelnummer: CSB-EP896765HU1
Artikelname: Recombinant Human E3 SUMO-protein ligase PIAS3 (PIAS3), partial
Artikelnummer: CSB-EP896765HU1
Hersteller Artikelnummer: CSB-EP896765HU1
Alternativnummer: CSB-EP896765HU1-1, CSB-EP896765HU1-100, CSB-EP896765HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: E3 SUMO-protein transferase PIAS3,Protein inhibitor of activated STAT protein 3
Molekulargewicht: 46.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9Y6X2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 112-467aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTC
Anwendungsbeschreibung: Research Areas: Cancer