Recombinant Human E3 SUMO-protein ligase PIAS3 (PIAS3), partial

Catalog Number: CSB-EP896765HU1
Article Name: Recombinant Human E3 SUMO-protein ligase PIAS3 (PIAS3), partial
Biozol Catalog Number: CSB-EP896765HU1
Supplier Catalog Number: CSB-EP896765HU1
Alternative Catalog Number: CSB-EP896765HU1-1, CSB-EP896765HU1-100, CSB-EP896765HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: E3 SUMO-protein transferase PIAS3,Protein inhibitor of activated STAT protein 3
Molecular Weight: 46.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9Y6X2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 112-467aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTC
Application Notes: Research Areas: Cancer