Recombinant Human Chromogranin-A (CHGA), partial
Artikelnummer:
CSB-MP005344HU1
- Bilder (0)
| Artikelname: | Recombinant Human Chromogranin-A (CHGA), partial |
| Artikelnummer: | CSB-MP005344HU1 |
| Hersteller Artikelnummer: | CSB-MP005344HU1 |
| Alternativnummer: | CSB-MP005344HU1-1, CSB-MP005344HU1-100, CSB-MP005344HU1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Pituitary secretory protein I |
| Molekulargewicht: | 21.3 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | P10645 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 19-197aa |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGP |
Produktgarantie und fachkundiger Support
