Recombinant Human Chromogranin-A (CHGA), partial
Catalog Number:
CSB-MP005344HU1
- Images (0)
| Article Name: | Recombinant Human Chromogranin-A (CHGA), partial |
| Biozol Catalog Number: | CSB-MP005344HU1 |
| Supplier Catalog Number: | CSB-MP005344HU1 |
| Alternative Catalog Number: | CSB-MP005344HU1-1, CSB-MP005344HU1-100, CSB-MP005344HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Pituitary secretory protein I |
| Molecular Weight: | 21.3 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | P10645 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 19-197aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGP |
Product Guarantee and Expert Support
