Recombinant Macaca mulatta Interleukin-10 (IL10)

Artikelnummer: CSB-MP011580MOWK5
Artikelname: Recombinant Macaca mulatta Interleukin-10 (IL10)
Artikelnummer: CSB-MP011580MOWK5
Hersteller Artikelnummer: CSB-MP011580MOWk5
Alternativnummer: CSB-MP011580MOWK5-1, CSB-MP011580MOWK5-100, CSB-MP011580MOWK5-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Cytokine synthesis inhibitory factor (CSIF)
Molekulargewicht: 32.7 kDa
Tag: N-terminal DEEP1-tagged and C-terminal 6xHis-tagged
UniProt: P51496
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 19-178aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN