Recombinant Macaca mulatta Interleukin-10 (IL10)
Catalog Number:
CSB-MP011580MOWK5
- Images (0)
| Article Name: | Recombinant Macaca mulatta Interleukin-10 (IL10) |
| Biozol Catalog Number: | CSB-MP011580MOWK5 |
| Supplier Catalog Number: | CSB-MP011580MOWk5 |
| Alternative Catalog Number: | CSB-MP011580MOWK5-1, CSB-MP011580MOWK5-100, CSB-MP011580MOWK5-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cytokine synthesis inhibitory factor (CSIF) |
| Molecular Weight: | 32.7 kDa |
| Tag: | N-terminal DEEP1-tagged and C-terminal 6xHis-tagged |
| UniProt: | P51496 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 19-178aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
Product Guarantee and Expert Support
