Recombinant Human Interleukin-11 (IL11)
Artikelnummer:
CSB-MP011583HU
- Bilder (0)
| Artikelname: | Recombinant Human Interleukin-11 (IL11) |
| Artikelnummer: | CSB-MP011583HU |
| Hersteller Artikelnummer: | CSB-MP011583HU |
| Alternativnummer: | CSB-MP011583HU-1, CSB-MP011583HU-100, CSB-MP011583HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Adipogenesis inhibitory factor |
| Molekulargewicht: | 45.2 kDa |
| Tag: | N-terminal hFc1-tagged |
| UniProt: | P20809 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 22-199aa |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Produktgarantie und fachkundiger Support
