Recombinant Human Interleukin-11 (IL11)
Catalog Number:
CSB-MP011583HU
- Images (0)
| Article Name: | Recombinant Human Interleukin-11 (IL11) |
| Biozol Catalog Number: | CSB-MP011583HU |
| Supplier Catalog Number: | CSB-MP011583HU |
| Alternative Catalog Number: | CSB-MP011583HU-1, CSB-MP011583HU-100, CSB-MP011583HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Adipogenesis inhibitory factor |
| Molecular Weight: | 45.2 kDa |
| Tag: | N-terminal hFc1-tagged |
| UniProt: | P20809 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 22-199aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Product Guarantee and Expert Support
