Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)

Artikelnummer: CSB-MP011588HU3
Artikelname: Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)
Artikelnummer: CSB-MP011588HU3
Hersteller Artikelnummer: CSB-MP011588HU3
Alternativnummer: CSB-MP011588HU3-1, CSB-MP011588HU3-100, CSB-MP011588HU3-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: IL12R, IL12RB
Molekulargewicht: 58.5 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P42701
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Mammalian cell
Expression System: 24-540aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGT
Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 µg/mL can bind Anti-IL12RB1 recombinant antibody(CSB-RA011588MA1HU). The EC50 is 1.578-2.143 ng/mL.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.