Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)

Catalog Number: CSB-MP011588HU3
Article Name: Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)
Biozol Catalog Number: CSB-MP011588HU3
Supplier Catalog Number: CSB-MP011588HU3
Alternative Catalog Number: CSB-MP011588HU3-1, CSB-MP011588HU3-100, CSB-MP011588HU3-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: IL12R, IL12RB
Molecular Weight: 58.5 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P42701
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Mammalian cell
Expression System: 24-540aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGT
Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 µg/mL can bind Anti-IL12RB1 recombinant antibody(CSB-RA011588MA1HU). The EC50 is 1.578-2.143 ng/mL.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.