Recombinant Human Interleukin-13 (IL13)

Produktübersicht

• Artikelname: Recombinant Human Interleukin-13 (IL13)
• Artikelnummer: CSB-MP011590HU
• Hersteller Artikelnummer: CSB-MP011590HU
• Alternativnummer: CSB-MP011590HU-1, CSB-MP011590HU-100, CSB-MP011590HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 42.2 kDa
• Tag: C-terminal hFc1-tagged
• UniProt: P35225
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 25-146aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN