Recombinant Human Interleukin-13 (IL13)
Catalog Number:
CSB-MP011590HU
- Images (0)
| Article Name: | Recombinant Human Interleukin-13 (IL13) |
| Biozol Catalog Number: | CSB-MP011590HU |
| Supplier Catalog Number: | CSB-MP011590HU |
| Alternative Catalog Number: | CSB-MP011590HU-1, CSB-MP011590HU-100, CSB-MP011590HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | / |
| Molecular Weight: | 42.2 kDa |
| Tag: | C-terminal hFc1-tagged |
| UniProt: | P35225 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 25-146aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Product Guarantee and Expert Support
