Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)

Produktübersicht

• Artikelname: Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)
• Artikelnummer: CSB-MP012474HU1
• Hersteller Artikelnummer: CSB-MP012474HU1
• Alternativnummer: CSB-MP012474HU1-1, CSB-MP012474HU1-100, CSB-MP012474HU1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314)

Produkteigenschaften

• Molekulargewicht: 43.6 kDa
• Tag: C-terminal hFc1-tagged
• UniProt: P26718
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Mammalian cell
• Expression System: 78-216aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Bilder

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 µg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.