Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)

Catalog Number: CSB-MP012474HU1
Article Name: Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)
Biozol Catalog Number: CSB-MP012474HU1
Supplier Catalog Number: CSB-MP012474HU1
Alternative Catalog Number: CSB-MP012474HU1-1, CSB-MP012474HU1-100, CSB-MP012474HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314)
Molecular Weight: 43.6 kDa
Tag: C-terminal hFc1-tagged
UniProt: P26718
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Mammalian cell
Expression System: 78-216aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 µg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.