Recombinant Mouse Leukocyte cell-derived chemotaxin-2(Lect2)

Artikelnummer: CSB-MP012855MO
Artikelname: Recombinant Mouse Leukocyte cell-derived chemotaxin-2(Lect2)
Artikelnummer: CSB-MP012855MO
Hersteller Artikelnummer: CSB-MP012855MO
Alternativnummer: CSB-MP012855MO-1, CSB-MP012855MO-100, CSB-MP012855MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Chondromodulin II
Molekulargewicht: 17.3 kDa
Tag: C-terminal 10xHis-tagged
UniProt: O88803
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.21.
Quelle: Mammalian cell
Expression System: 19-151aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL
Anwendungsbeschreibung: Research Areas: Developmental Biology