Recombinant Mouse Leukocyte cell-derived chemotaxin-2(Lect2)

Catalog Number: CSB-MP012855MO
Article Name: Recombinant Mouse Leukocyte cell-derived chemotaxin-2(Lect2)
Biozol Catalog Number: CSB-MP012855MO
Supplier Catalog Number: CSB-MP012855MO
Alternative Catalog Number: CSB-MP012855MO-1, CSB-MP012855MO-100, CSB-MP012855MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Chondromodulin II
Molecular Weight: 17.3 kDa
Tag: C-terminal 10xHis-tagged
UniProt: O88803
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.21.
Source: Mammalian cell
Expression System: 19-151aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL
Application Notes: Research Areas: Developmental Biology