Recombinant Human Galectin-3 (LGALS3)

Produktübersicht

• Artikelname: Recombinant Human Galectin-3 (LGALS3)
• Artikelnummer: CSB-MP012887HU(A4)D7
• Hersteller Artikelnummer: CSB-MP012887HU(A4)d7
• Alternativnummer: CSB-MP012887HU(A4)D7-1, CSB-MP012887HU(A4)D7-100, CSB-MP012887HU(A4)D7-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 35 kDa lectin,Carbohydrate-binding protein 35,Galactose-specific lectin 3,Galactoside-binding protein,IgE-binding protein,L-31,Laminin-binding protein,Lectin L-29,Mac-2 antigen

Produkteigenschaften

• Molekulargewicht: 28.9 kDa
• Tag: C-terminal 10xHis-tagged
• UniProt: P17931
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 1-250aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Research Areas: Metabolism. Endotoxin: Not test