Recombinant Human Galectin-3 (LGALS3)

Catalog Number: CSB-MP012887HU(A4)D7
Article Name: Recombinant Human Galectin-3 (LGALS3)
Biozol Catalog Number: CSB-MP012887HU(A4)D7
Supplier Catalog Number: CSB-MP012887HU(A4)d7
Alternative Catalog Number: CSB-MP012887HU(A4)D7-1, CSB-MP012887HU(A4)D7-100, CSB-MP012887HU(A4)D7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 35 kDa lectin,Carbohydrate-binding protein 35,Galactose-specific lectin 3,Galactoside-binding protein,IgE-binding protein,L-31,Laminin-binding protein,Lectin L-29,Mac-2 antigen
Molecular Weight: 28.9 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P17931
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 1-250aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Application Notes: Research Areas: Metabolism. Endotoxin: Not test