Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)

Produktübersicht

• Artikelname: Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)
• Artikelnummer: CSB-MP015665HU
• Hersteller Artikelnummer: CSB-MP015665HU
• Alternativnummer: CSB-MP015665HU-1, CSB-MP015665HU-100, CSB-MP015665HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Complex I-13kD-A,NADH-ubiquinone oxidoreductase 13 kDa-A subunit

Produkteigenschaften

• Molekulargewicht: 12.8 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O75380
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.17.
• Quelle: Mammalian cell
• Expression System: 29-124aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Research Areas: Signal transduction