Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)

Catalog Number: CSB-MP015665HU
Article Name: Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)
Biozol Catalog Number: CSB-MP015665HU
Supplier Catalog Number: CSB-MP015665HU
Alternative Catalog Number: CSB-MP015665HU-1, CSB-MP015665HU-100, CSB-MP015665HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Complex I-13kD-A,NADH-ubiquinone oxidoreductase 13 kDa-A subunit
Molecular Weight: 12.8 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O75380
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.17.
Source: Mammalian cell
Expression System: 29-124aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Application Notes: Research Areas: Signal transduction