Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)

Artikelnummer: CSB-MP015665HUD9
Artikelname: Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)
Artikelnummer: CSB-MP015665HUD9
Hersteller Artikelnummer: CSB-MP015665HUd9
Alternativnummer: CSB-MP015665HUD9-1, CSB-MP015665HUD9-100, CSB-MP015665HUD9-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Complex I-13kD-A,NADH-ubiquinone oxidoreductase 13 kDa-A subunit
Molekulargewicht: 39.6 kDa
Tag: C-terminal hFc1-tagged
UniProt: O75380
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.20.
Quelle: Mammalian cell
Expression System: 29-124aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Anwendungsbeschreibung: Research Areas: Signal transduction