Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)

Catalog Number: CSB-MP015665HUD9
Article Name: Recombinant Human NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial(NDUFS6)
Biozol Catalog Number: CSB-MP015665HUD9
Supplier Catalog Number: CSB-MP015665HUd9
Alternative Catalog Number: CSB-MP015665HUD9-1, CSB-MP015665HUD9-100, CSB-MP015665HUD9-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Complex I-13kD-A,NADH-ubiquinone oxidoreductase 13 kDa-A subunit
Molecular Weight: 39.6 kDa
Tag: C-terminal hFc1-tagged
UniProt: O75380
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.20.
Source: Mammalian cell
Expression System: 29-124aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Application Notes: Research Areas: Signal transduction