Recombinant Human Ribonuclease 4 (RNASE4)

Artikelnummer: CSB-MP019796HUD9
Artikelname: Recombinant Human Ribonuclease 4 (RNASE4)
Artikelnummer: CSB-MP019796HUD9
Hersteller Artikelnummer: CSB-MP019796HUd9
Alternativnummer: CSB-MP019796HUD9-1, CSB-MP019796HUD9-100, CSB-MP019796HUD9-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 42.7 kDa
Tag: C-terminal hFc1-tagged
UniProt: P34096
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.46.
Quelle: Mammalian cell
Expression System: 29-147aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Anwendungsbeschreibung: Research Areas: Cardiovascular