Recombinant Human Ribonuclease 4 (RNASE4)

Catalog Number: CSB-MP019796HUD9
Article Name: Recombinant Human Ribonuclease 4 (RNASE4)
Biozol Catalog Number: CSB-MP019796HUD9
Supplier Catalog Number: CSB-MP019796HUd9
Alternative Catalog Number: CSB-MP019796HUD9-1, CSB-MP019796HUD9-100, CSB-MP019796HUD9-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 42.7 kDa
Tag: C-terminal hFc1-tagged
UniProt: P34096
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.46.
Source: Mammalian cell
Expression System: 29-147aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Application Notes: Research Areas: Cardiovascular