Recombinant Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12), partial
Artikelnummer:
CSB-MP023987MO1
- Bilder (0)
| Artikelname: | Recombinant Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12), partial |
| Artikelnummer: | CSB-MP023987MO1 |
| Hersteller Artikelnummer: | CSB-MP023987MO1 |
| Alternativnummer: | CSB-MP023987MO1-1,CSB-MP023987MO1-100,CSB-MP023987MO1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | TNF-related weak inducer of apoptosis |
| Molekulargewicht: | 44.8 kDa |
| Tag: | N-terminal hFc1-tagged and C-terminal 10xHis-tagged |
| UniProt: | O54907 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 94-249aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Produktgarantie und fachkundiger Support
