Recombinant Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12), partial
Catalog Number:
CSB-MP023987MO1
- Images (0)
| Article Name: | Recombinant Mouse Tumor necrosis factor ligand superfamily member 12 (Tnfsf12), partial |
| Biozol Catalog Number: | CSB-MP023987MO1 |
| Supplier Catalog Number: | CSB-MP023987MO1 |
| Alternative Catalog Number: | CSB-MP023987MO1-1,CSB-MP023987MO1-100,CSB-MP023987MO1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | TNF-related weak inducer of apoptosis |
| Molecular Weight: | 44.8 kDa |
| Tag: | N-terminal hFc1-tagged and C-terminal 10xHis-tagged |
| UniProt: | O54907 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 94-249aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Product Guarantee and Expert Support
