Recombinant Human Tumor necrosis factor ligand superfamily member 1 (TNFSF15), partial

Produktübersicht

• Artikelname: Recombinant Human Tumor necrosis factor ligand superfamily member 1 (TNFSF15), partial
• Artikelnummer: CSB-MP023992HU(F3)
• Hersteller Artikelnummer: CSB-MP023992HU(F3)
• Alternativnummer: CSB-MP023992HU(F3)-1,CSB-MP023992HU(F3)-100,CSB-MP023992HU(F3)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: TNF ligand-related molecule 1,Vascular endothelial cell growth inhibitor

Produkteigenschaften

• Molekulargewicht: 20.0 kDa
• Tag: N-terminal 10xHis-tagged
• UniProt: O95150
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mammalian cell
• Expression System: 23-174aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKP