Recombinant Human Tumor necrosis factor ligand superfamily member 1 (TNFSF15), partial
Catalog Number:
CSB-MP023992HU(F3)
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor ligand superfamily member 1 (TNFSF15), partial |
| Biozol Catalog Number: | CSB-MP023992HU(F3) |
| Supplier Catalog Number: | CSB-MP023992HU(F3) |
| Alternative Catalog Number: | CSB-MP023992HU(F3)-1,CSB-MP023992HU(F3)-100,CSB-MP023992HU(F3)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | TNF ligand-related molecule 1,Vascular endothelial cell growth inhibitor |
| Molecular Weight: | 20.0 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | O95150 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 23-174aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKP |
Product Guarantee and Expert Support
