Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial

Artikelnummer: CSB-MP023992HU1C9
Artikelname: Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial
Artikelnummer: CSB-MP023992HU1C9
Hersteller Artikelnummer: CSB-MP023992HU1c9
Alternativnummer: CSB-MP023992HU1C9-1, CSB-MP023992HU1C9-100, CSB-MP023992HU1C9-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: TNF ligand-related molecule 1,Vascular endothelial cell growth inhibitor
Molekulargewicht: 46.5 kDa
Tag: N-terminal hFc1-tagged
UniProt: O95150
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 72-251aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Anwendungsbeschreibung: Research Areas: Cancer