Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial

Catalog Number: CSB-MP023992HU1C9
Article Name: Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial
Biozol Catalog Number: CSB-MP023992HU1C9
Supplier Catalog Number: CSB-MP023992HU1c9
Alternative Catalog Number: CSB-MP023992HU1C9-1, CSB-MP023992HU1C9-100, CSB-MP023992HU1C9-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: TNF ligand-related molecule 1,Vascular endothelial cell growth inhibitor
Molecular Weight: 46.5 kDa
Tag: N-terminal hFc1-tagged
UniProt: O95150
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 72-251aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Application Notes: Research Areas: Cancer