Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial
Artikelnummer:
CSB-MP023994MO1
- Bilder (0)
| Artikelname: | Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial |
| Artikelnummer: | CSB-MP023994MO1 |
| Hersteller Artikelnummer: | CSB-MP023994MO1 |
| Alternativnummer: | CSB-MP023994MO1-1, CSB-MP023994MO1-100, CSB-MP023994MO1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | OX40 ligand |
| Molekulargewicht: | 42.9 kDa |
| Tag: | N-terminal hFc1-tagged |
| UniProt: | P43488 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mammalian cell |
| Expression System: | 49-198aa |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL |
Produktgarantie und fachkundiger Support
