Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial

Artikelnummer: CSB-MP023994MO1B0
Artikelname: Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial
Artikelnummer: CSB-MP023994MO1B0
Hersteller Artikelnummer: CSB-MP023994MO1b0
Alternativnummer: CSB-MP023994MO1B0-1, CSB-MP023994MO1B0-100, CSB-MP023994MO1B0-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: OX40 ligand
Molekulargewicht: 20.5 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P43488
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.173.
Quelle: Mammalian cell
Expression System: 49-198aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Anwendungsbeschreibung: Research Areas: Signal Transduction