Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial

Catalog Number: CSB-MP023994MO1B0
Article Name: Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial
Biozol Catalog Number: CSB-MP023994MO1B0
Supplier Catalog Number: CSB-MP023994MO1b0
Alternative Catalog Number: CSB-MP023994MO1B0-1, CSB-MP023994MO1B0-100, CSB-MP023994MO1B0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: OX40 ligand
Molecular Weight: 20.5 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P43488
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.173.
Source: Mammalian cell
Expression System: 49-198aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Application Notes: Research Areas: Signal Transduction