Recombinant Macaca fascicularis Kallikrein-related peptidase 2 (KLK2)

Artikelnummer: CSB-MP2117MOVR10
Artikelname: Recombinant Macaca fascicularis Kallikrein-related peptidase 2 (KLK2)
Artikelnummer: CSB-MP2117MOVR10
Hersteller Artikelnummer: CSB-MP2117MOVr10
Alternativnummer: CSB-MP2117MOVR10-1, CSB-MP2117MOVR10-100, CSB-MP2117MOVR10-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: KLK2
Molekulargewicht: 97.1 kDa
Tag: C-terminal 10xHis-HSA-tagged
UniProt: M1L4S7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mammalian cell
Expression System: 18-270aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPLIQARIVGGWECEKHSQPWQAAVYSHGWAHCGGVLVLPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRAPVSHSFPHPLYNMSLLKRRSLRPDEDSSHDLMLLRLSEPAKITDAVKVLGLPTQEPALGTTCYASGWGSIQPKEFLRPKSLQCVNLHLLSNDMCAGAYSEKVTAFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYWKWIKDTIAANPRVPPSYPYL
Anwendungsbeschreibung: Research Areas: Others