Recombinant Macaca fascicularis Kallikrein-related peptidase 2 (KLK2)

Catalog Number: CSB-MP2117MOVR10
Article Name: Recombinant Macaca fascicularis Kallikrein-related peptidase 2 (KLK2)
Biozol Catalog Number: CSB-MP2117MOVR10
Supplier Catalog Number: CSB-MP2117MOVr10
Alternative Catalog Number: CSB-MP2117MOVR10-1, CSB-MP2117MOVR10-100, CSB-MP2117MOVR10-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: KLK2
Molecular Weight: 97.1 kDa
Tag: C-terminal 10xHis-HSA-tagged
UniProt: M1L4S7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 18-270aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPLIQARIVGGWECEKHSQPWQAAVYSHGWAHCGGVLVLPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRAPVSHSFPHPLYNMSLLKRRSLRPDEDSSHDLMLLRLSEPAKITDAVKVLGLPTQEPALGTTCYASGWGSIQPKEFLRPKSLQCVNLHLLSNDMCAGAYSEKVTAFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYWKWIKDTIAANPRVPPSYPYL
Application Notes: Research Areas: Others