Recombinant Human T-cell differentiation antigen CD6 (CD6), partial

Artikelnummer: CSB-MP326953HU
Artikelname: Recombinant Human T-cell differentiation antigen CD6 (CD6), partial
Artikelnummer: CSB-MP326953HU
Hersteller Artikelnummer: CSB-MP326953HU
Alternativnummer: CSB-MP326953HU-1, CSB-MP326953HU-100, CSB-MP326953HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: T12,TP120
Molekulargewicht: 43.3 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P30203
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.172.
Quelle: Mammalian cell
Expression System: 18-398aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: HPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGAD
Anwendungsbeschreibung: Research Areas: Immunology