Recombinant Human T-cell differentiation antigen CD6 (CD6), partial

Catalog Number: CSB-MP326953HU
Article Name: Recombinant Human T-cell differentiation antigen CD6 (CD6), partial
Biozol Catalog Number: CSB-MP326953HU
Supplier Catalog Number: CSB-MP326953HU
Alternative Catalog Number: CSB-MP326953HU-1, CSB-MP326953HU-100, CSB-MP326953HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: T12,TP120
Molecular Weight: 43.3 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P30203
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.172.
Source: Mammalian cell
Expression System: 18-398aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGAD
Application Notes: Research Areas: Immunology